PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_012721-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 291aa    MW: 31371.4 Da    PI: 9.5623
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_012721-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.71.3e-08653346
                     SS-HHHHHHHHHHHHHTTTT.....-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg.....tWktIartmgkgRtlkqcksrwqk 46
                      W+ eE++ +  a++++        +W++Ia++++  +t  ++k ++  
    NNU_012721-RA  6 GWSREEEKAFETAIAMHWASddskdRWEKIASMVP-SKTVAELKKHYEV 53
                     6****************9999**************.**********965 PP

2Myb_DNA-binding391.9e-12133177347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ +  ++G+g+W++I+r +   Rt+ q+ s+ qky
    NNU_012721-RA 133 PWTEEEHRLFLLGLDKFGKGDWRSISRNFVISRTPTQVASHAQKY 177
                      7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129310.786159IPR017884SANT domain
SMARTSM007173.9E-7357IPR001005SANT/Myb domain
PfamPF002491.0E-6552IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-5554IPR009057Homeodomain-like
SuperFamilySSF466891.63E-9662IPR009057Homeodomain-like
CDDcd001673.72E-9755No hitNo description
PROSITE profilePS5129417.282125182IPR017930Myb domain
SuperFamilySSF466896.83E-17128183IPR009057Homeodomain-like
SMARTSM007172.3E-10130180IPR001005SANT/Myb domain
TIGRFAMsTIGR015574.0E-17130180IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.1E-11131176IPR009057Homeodomain-like
CDDcd001679.27E-10133178No hitNo description
PfamPF002497.0E-11133177IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MASVGGWSRE EEKAFETAIA MHWASDDSKD RWEKIASMVP SKTVAELKKH YEVLVEDVDA  60
IESGRIPIPT YVKEAAANSK DQHLFLASAS GAADKRLNCN FGTGFSGLGT DSGGGQGGKA  120
GSRSDQERRK GIPWTEEEHR LFLLGLDKFG KGDWRSISRN FVISRTPTQV ASHAQKYFIR  180
LNSMNRDRRR SSIHDITSVN SGDVSSPQAP ITGQQPHNTA AAAAAPASAK HRPPQPNMPG  240
VGMYGPPIGQ PVAAPPHMVS AVGTPVMLPP GHHPPYMVPM AYPVAPPTLH Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-16185187RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00191DAPTransfer from AT1G49010Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010265272.10.0PREDICTED: transcription factor DIVARICATA-like
TrEMBLU5FTN21e-136U5FTN2_POPTR; Uncharacterized protein
STRINGPOPTR_0012s05720.11e-135(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49010.11e-78MYB family protein